Protein-Tag

Als Protein-Tag, Affinitäts-Tag oder Epitop-Tag (engl. tag für ‚Markierung‘, ‚Schildchen‘ oder ‚Etikett‘) werden in der Biochemie verschiedene, meist kurze Aminosäuresequenzen bezeichnet, mit deren Hilfe Proteine markiert werden können. Die derart markierten Proteine gehören zu den Fusionsproteinen. Begrifflich und funktionell analog, aber auf Nukleinsäure-Ebene, werden heute bei vielen modernen Methoden der DNA-Sequenzierung und Klonierung, etwa von Genbibliotheken, auch DNA-Tags (Barcodes) verwendet, um Moleküle identifizierbar zu markieren.

Anwendungen

A) His-Tag bereits im Vektor vorliegend, B) Einfügen der DNA-Sequenz des His-Tags mit dem Transgen in den Vektor.
N-terminale Histag-Primersequenz ab dem Start-Codon (links), C-terminale His-Tag-Primersequenz bis zum Stop-Codon (rechts).

Für verschiedene Zwecke sind die verschiedenen Markierungen unterschiedlich gut geeignet. Sie werden im Zuge des Proteindesigns bei der Erzeugung rekombinanter Proteine mit einem Expressionsvektor, bzw. deren Reinigung und Nachweis über die Affinitätschromatografie, über Pulldown-Assays, per Western Blot, per Immunhistochemie, per Fluoreszenzmikroskopie oder im Live-Imaging (siehe Moderne Untersuchungsmethoden in der Zellbiologie) eingesetzt.

Zur Erzeugung eines Protein-Tags wird die codierende DNA-Sequenz des Protein-Tags unter Erhalt des Leserasters in die codierende DNA-Sequenz des Fusionsproteins hinter das Start-Codon oder vor das Stop-Codon eingefügt. Dadurch entsteht ein N-terminales bzw. ein C-terminales Protein-Tag am Protein während der Translation.

Gelegentlich muss das Protein-Tag vom Protein nach der Reinigung entfernt werden, was z. B. durch eine Protease-Schnittstelle, 2A-Peptide oder ein induzierbares Intein erreicht werden kann. Der Proteolyse-basierte Ansatz verwendet Proteasen mit längerer Erkennungssequenz, die möglichst nur an der Schnittstelle des Protein-Tags schneiden, z. B. die TEV-Protease,[1] Thrombin, Faktor Xa oder Enteropeptidase. Inteine können durch Thiole oder durch Absenken des pH-Werts ausgelöst werden.[2][3][4]

Alle Protein-Tags erlauben eine der folgenden Methoden:

  • Immunaffinitätschromatografische Aufreinigung (mit den entsprechenden Antikörpern)
  • Antikörperbasierte Nachweise (z. B. per Western Blot, Immunhistochemie oder Immunfluoreszenz)

Einige Tags besitzen neben der Bindung eines Antikörpers oder Immunkonjugats noch andere Funktionen wie:

Protein-Tags

  • 18A-Tag (Sequenz: EWLKAFYEKVLEKLKEL)[5]
  • ACP-Tag
  • Aldehyd-Tag[6]
  • ALFA-tag (Sequenz: SRLEEELRRRLTE)[7]
  • Avi-Tag (Sequenz: GLNDIFEAQKIEWHE)
  • BCCP-Tag
  • Calmodulin-Tag (CaM-Tag, Sequenz: KRRWKKNFIAVSAANRFKKISSSGAL)
  • Chitin-bindendes Protein-Tag (CBP-Tag)
  • E-Tag (Sequenz: GAPVPYPDPLEPR)
  • ELK16-Tag (Sequenz: LELELKLKLELELKLK)[5]
  • ELP-Tag[8]
  • FLAG-Tag (Sequenz: DYKDDDDK)[9]
  • Flash-Tag (Sequenz: CCXXCC)[10]
  • poly-Glutamat-Tag (Sequenz: EEEEEE)
  • Glutathion-S-Transferase-Tag (GST-Tag)[11]
  • Green-fluorescent-protein-Tag (GFP-Tag)
  • HaloTag[12]
  • Hämagglutinin-Tag (HA-Tag, Sequenz: YPYDVPDYA)[13]
  • poly-Histidin-Tag (His-Tag, Sequenz: HHHHHH)[14]
  • Isopeptag (Sequenz: TDKDMTITFTNKKDAE)[15]
  • Maltose-bindendes Protein-Tag (MBP-Tag)[16]
  • Myc-Tag (Sequenz: EQKLISEEDL)
  • NE-Tag (Sequenz: TKENPRSNQEESYDDNES)[17]
  • Nus-Tag
  • ProtA-Tag
  • ProtC-Tag
  • Rho1d4 tag, leitet sich von den c-terminalen 9 Aminosäuren des Rinder-Rhodopsins (TETSQVAPA) ab. Sehr spezifischer tag, welcher sich besonders für die Aufreinigung von Membranproteinen eignet.[18]
  • S-Tag (Sequenz: KETAAAKFERQHMDS)
  • SBP-Tag (Sequenz: MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP)[19]
  • Snap-Tag
  • SnoopTag (Sequenz: KLGDIEFIKVNK)[20]
  • SofTag 1 und 3 (Sequenzen: SLAELLNAGLGGS bzw. TQDPSRVG)
  • SpyTag (Sequenz: AHIVMVDAYKPTK)[21]
  • Streptavidin-Tag (Strep-Tag, Sequenz: AWRHPQFGG)[22]
  • Strep (Sequenz: WSHPQFEK)
  • T7 Epitope Tag (Sequenz: MASMTGGQQMG)
  • Tandem-Affinity-Purification-Tag (TAP-Tag)
  • TC-Tag (Sequenz: CCPGCC)
  • Thioredoxin-Tag (TRX-Tag)
  • Ty-Tag (Sequenz: EVHTNQDPLD)
  • V5-Tag (Sequenz: GKPIPNPLLGLDST)
  • VSV-Tag (Sequenz: YTDIEMNRLGK)
  • Xpress-Tag (Sequenz: DLYDDDDK)

Geschichte

Das erste Protein-Tag wurde 1984 von S. Munro und H. R. Pelham veröffentlicht und bestand aus einem Teil des Neuropeptids Substanz P.[23] Die nächsten Protein-Tags waren im Jahr 1986 das Myc-Tag[24][25] und 1988 das MBP-Tag,[16] das HA-Tag,[13] das His-Tag[14] und das FLAG-Tag.[9]

Siehe auch

Einzelnachweise

  1. ↑ G. Rigaut et al.: A generic protein purification method for protein complex characterization and proteome exploration. In: Nature Biotechnology. 17. Jahrgang, Nr. 10, 1999, S. 1030–1032, doi:10.1038/13732, PMID 10504710 (englisch).
  2. ↑ S. Chong, F. B. Mersha, D. G. Comb, M. E. Scott, D. Landry, L. M. Vence, F. B. Perler, J. Benner, R. B. Kucera, C. A. Hirvonen, J. J. Pelletier, H. Paulus, M. Q. Xu: Single-column purification of free recombinant proteins using a self-cleavable affinity tag derived from a protein splicing element. In: Gene (1997), Band 192(2), S. 271–281. PMID 9224900.
  3. ↑ S. Chong, G. E. Montello, A. Zhang, E. J. Cantor, W. Liao, M. Q. Xu, J. Benner: Utilizing the C-terminal cleavage activity of a protein splicing element to purify recombinant proteins in a single chromatographic step. In: Nucleic Acids Res. (1998), Band 26(22), S. 5109–15. PMID 9801307; PMC 147948 (freier Volltext).
  4. ↑ D. W. Wood, W. Wu, G. Belfort, V. Derbyshire, M. Belfort: A genetic system yields self-cleaving inteins for bioseparations. In: Nat Biotechnol. (1999), Band 17(9), S. 889–892. PMID 10471931.
  5. ↑ a b L. Xing, W. Wu, B. Zhou, Z. Lin: Streamlined protein expression and purification using cleavable self-aggregating tags. In: Microb Cell Fact. (2011), Band 10, S. 42. PMID 21631955; PMC 3124420 (freier Volltext).
  6. ↑ I. S. Carrico, B. L. Carlson, Carolyn Bertozzi: Introducing genetically encoded aldehydes into proteins. In: Nature chemical biology. Band 3, Nummer 6, Juni 2007, S. 321–322, doi:10.1038/nchembio878. PMID 17450134.
  7. ↑ Hansjörg Götzke, Markus Kilisch, Markel Martínez-Carranza, Shama Sograte-Idrissi, Abirami Rajavel: The ALFA-tag is a highly versatile tool for nanobody-based bioscience applications. In: Nature Communications. Band 10, Nr. 1, 27. September 2019, ISSN 2041-1723, S. 1–12, doi:10.1038/s41467-019-12301-7, PMID 31562305, PMC 6764986 (freier Volltext).
  8. ↑ B. A. Fong, D. W. Wood: Expression and purification of ELP-intein-tagged target proteins in high cell density E. coli fermentation. In: Microb Cell Fact. (2010), Band 9, S. 77. PMID 20959011; PMC 2978133 (freier Volltext).
  9. ↑ a b Thomas P. Hopp, Kathryn S. Prickett, Virginia L. Price, Randell T. Libby, Carl J. March, Douglas Pat Cerretti, David L. Urdal, Paul J. Conlon: A Short Polypeptide Marker Sequence Useful for Recombinant Protein Identification and Purification. In: Bio/Technology. 6, 1988, S. 1204, doi:10.1038/nbt1088-1204.
  10. ↑ B. A. Griffin, S. R. Adams, R. Y. Tsien: Specific covalent labeling of recombinant protein molecules inside live cells. In: Science. Band 281, Nummer 5374, Juli 1998, S. 269–272, PMID 9657724.
  11. ↑ D. B. Smith, K. S. Johnson: Single-step purification of polypeptides expressed in Escherichia coli as fusions with glutathione S-transferase. In: Gene. Band 67, Nummer 1, Juli 1988, S. 31–40, PMID 3047011.
  12. ↑ Georgyi V. Los, Lance P. Encell, Mark G. McDougall, Danette D. Hartzell, Natasha Karassina, Chad Zimprich, Monika G. Wood, Randy Learish, Rachel Friedman Ohana, Marjeta Urh, Dan Simpson, Jacqui Mendez, Kris Zimmerman, Paul Otto, Gediminas Vidugiris, Ji Zhu, Aldis Darzins, Dieter H. Klaubert, Robert F. Bulleit, Keith V. Wood: HaloTag: A Novel Protein Labeling Technology for Cell Imaging and Protein Analysis. In: ACS Chemical Biology. Band 3, Nr. 6, 1. Juni 2008, ISSN 1554-8929, S. 373–382, doi:10.1021/cb800025k.
  13. ↑ a b J. Field, J. Nikawa, D. Broek, B. MacDonald, L. Rodgers, I. A. Wilson, R. A. Lerner, M. Wigler: Purification of a RAS-responsive adenylyl cyclase complex from Saccharomyces cerevisiae by use of an epitope addition method. In: Molecular and cellular biology. Band 8, Nummer 5, Mai 1988, S. 2159–2165, PMID 2455217, PMC 363397 (freier Volltext).
  14. ↑ a b E. Hochuli, W. Bannwarth, H. Döbeli, R. Gentz, D. Stüber: Genetic Approach to Facilitate Purification of Recombinant Proteins with a Novel Metal Chelate Adsorbent. In: Nature Biotechnology. 6, 1988, S. 1321, doi:10.1038/nbt1188-1321.
  15. ↑ B. Zakeri, M. Howarth: Spontaneous intermolecular amide bond formation between side chains for irreversible peptide targeting. In: Journal of the American Chemical Society. Band 132, Nummer 13, April 2010, S. 4526–4527, doi:10.1021/ja910795a. PMID 20235501.
  16. ↑ a b H. Bedouelle, P. Duplay: Production in Escherichia coli and one-step purification of bifunctional hybrid proteins which bind maltose. Export of the Klenow polymerase into the periplasmic space. In: European Journal of Biochemistry. Band 171, Nummer 3, Februar 1988, S. 541–549, PMID 3278900.
  17. ↑ P. W. Ho, Z. H. Tse, H. F. Liu, S. Lu, J. W. Ho, M. H. Kung, D. B. Ramsden, S. L. Ho: Assessment of cellular estrogenic activity based on estrogen receptor-mediated reduction of soluble-form catechol-O-methyltransferase (COMT) expression in an ELISA-based system. In: PloS one. Band 8, Nummer 9, 2013, S. e74065, doi:10.1371/journal.pone.0074065, PMID 24040167, PMC 3765251 (freier Volltext).
  18. ↑ L. L. Molday, R. S. Molday: 1D4: a versatile epitope tag for the purification and characterization of expressed membrane and soluble proteins. In: Methods in molecular biology. Band 1177, 2014, S. 1–15, doi:10.1007/978-1-4939-1034-2_1, PMID 24943310, PMC 4227631 (freier Volltext).
  19. ↑ A. D. Keefe, D. S. Wilson, B. Seelig, J. W. Szostak: One-step purification of recombinant proteins using a nanomolar-affinity streptavidin-binding peptide, the SBP-Tag. In: Protein expression and purification. Band 23, Nummer 3, Dezember 2001, S. 440–446, doi:10.1006/prep.2001.1515, PMID 11722181.
  20. ↑ G. Veggiani, T. Nakamura, M. D. Brenner, R. V. Gayet, J. Yan, C. V. Robinson, M. Howarth: Programmable polyproteams built using twin peptide superglues. In: Proceedings of the National Academy of Sciences. Band 113, Nummer 5, Februar 2016, S. 1202–1207, doi:10.1073/pnas.1519214113, PMID 26787909, PMC 4747704 (freier Volltext).
  21. ↑ B. Zakeri, J. O. Fierer, E. Celik, E. C. Chittock, U. Schwarz-Linek, V. T. Moy, M. Howarth: Peptide tag forming a rapid covalent bond to a protein, through engineering a bacterial adhesin. In: Proceedings of the National Academy of Sciences. Band 109, Nummer 12, März 2012, S. E690–E697, doi:10.1073/pnas.1115485109. PMID 22366317. PMC 3311370 (freier Volltext).
  22. ↑ T. G. Schmidt, J. Koepke, R. Frank, A. Skerra: Molecular interaction between the Strep-tag affinity peptide and its cognate target, streptavidin. In: Journal of molecular biology. Band 255, Nummer 5, Februar 1996, S. 753–766, doi:10.1006/jmbi.1996.0061, PMID 8636976.
  23. ↑ S. Munro, H. R. Pelham: Use of peptide tagging to detect proteins expressed from cloned genes: deletion mapping functional domains of Drosophila hsp 70. In: The EMBO journal. Band 3, Nummer 13, Dezember 1984, S. 3087–3093, PMID 6526011, PMC 557822 (freier Volltext).
  24. ↑ Sean Munro, Hugh R.B. Pelham: An hsp70-like protein in the ER: Identity with the 78 kd glucose-regulated protein and immunoglobulin heavy chain binding protein. In: Cell. 46, 1986, S. 291, doi:10.1016/0092-8674(86)90746-4.
  25. ↑ Ashley Waldron: Of Myc and Men. In: blog.addgene.org. 19. Januar 2023, abgerufen am 25. Januar 2023 (englisch).

Auf dieser Seite verwendete Medien

His-tag.png
Autor/Urheber: Der ursprünglich hochladende Benutzer war Jfhaller in der Wikipedia auf Englisch, Lizenz: FAL
Adding polyhistidine tags. A) The His-tag is added by inserting the DNA coding a protein of interest in a vector that has the tag ready to fuse at the C-terminal. B)The His-tag is added using primers containing the tag, after a PCR reaction the tag gets fused to the N-terminal of the gene. AAAsBiophysics 20:29, 17 July 2007 (UTC)
His-tag-primers.png
Autor/Urheber: Der ursprünglich hochladende Benutzer war Jfhaller in der Wikipedia auf Englisch, Lizenz: FAL
Example of primer designed to add a 6xHis-tag using PCR. Eighteen bases coding six histidines are inserted right after the STAR codon or right before the STOP codon. At least 16 bases specific of a gene of interest are need it next to the His-tag. AAAsBiophysics 20:27, 17 July 2007 (UTC)